Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)
Search SCOP (example):

Lineage for d1l9jd_ (1l9j D:)

  1. Root: SCOP 1.75
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. Family a.3.1.1: monodomain cytochrome c [46627] (15 protein domains)
  6. Protein Cytochrome c2 [46650] (8 species)
  7. Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries)
  8. Domain d1l9jd_: 1l9j D: [73723]
    Other proteins in same PDB: d1l9jh1, d1l9jh2, d1l9jl_, d1l9jm_, d1l9jr_, d1l9js_, d1l9jt1, d1l9jt2
    complexed with bcl, bph, cl, fe2, hem, lda, u10

Details for d1l9jd_

PDB Entry: 1l9j (more details)
PDB Description: x-ray structure of the cytochrome-c(2)-photosynthetic reacti electron transfer complex from rhodobacter sphaeroides in t crystals
PDB Compounds: (D:) cytochrome c-2

SCOP Domain Sequences for d1l9jd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9jd_ a.3.1.1 (D:) Cytochrome c2 {Rhodobacter sphaeroides [TaxId: 1063]}
qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
avrp

SCOP Domain Coordinates for d1l9jd_:

Click to download the PDB-style file with coordinates for d1l9jd_.
(The format of our PDB-style files is described here.)

Timeline for d1l9jd_:

d1l9jd_ appears in SCOP 1.73
d1l9jd_ appears in SCOP 1.75A


d1l9jd_
(click for larger image)


d1l9jd_ in context of chain



d1l9jd_ in context of PDB
Domains from other chains:
d1l9jc_, d1l9jh1, d1l9jh2, d1l9jl_, d1l9jm_, d1l9jr_, d1l9js_, d1l9jt1, d1l9jt2


SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu