Lineage for d1l9jd_ (1l9j D:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149460Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 149461Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 149462Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 149466Protein Cytochrome c2 [46650] (8 species)
  7. 149474Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries)
  8. 149481Domain d1l9jd_: 1l9j D: [73723]
    Other proteins in same PDB: d1l9jh1, d1l9jh2, d1l9jl1, d1l9jm1, d1l9jr1, d1l9js1, d1l9jt1, d1l9jt2

Details for d1l9jd_

PDB Entry: 1l9j (more details), 3.25 Å

PDB Description: X-Ray Structure of the Cytochrome-c(2)-Photosynthetic Reaction Center Electron Transfer Complex from Rhodobacter sphaeroides in Type I Co-Crystals

SCOP Domain Sequences for d1l9jd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9jd_ a.3.1.1 (D:) Cytochrome c2 {Rhodobacter sphaeroides}
qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
avrp

SCOP Domain Coordinates for d1l9jd_:

Click to download the PDB-style file with coordinates for d1l9jd_.
(The format of our PDB-style files is described here.)

Timeline for d1l9jd_: