Lineage for d1l9jc_ (1l9j C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257168Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1257169Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1257170Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1257181Protein Cytochrome c2 [46650] (8 species)
  7. 1257191Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries)
  8. 1257197Domain d1l9jc_: 1l9j C: [73722]
    Other proteins in same PDB: d1l9jh1, d1l9jh2, d1l9jl_, d1l9jm_, d1l9jr_, d1l9js_, d1l9jt1, d1l9jt2
    complexed with bcl, bph, cl, fe2, hem, lda, u10

Details for d1l9jc_

PDB Entry: 1l9j (more details), 3.25 Å

PDB Description: X-Ray Structure of the Cytochrome-c(2)-Photosynthetic Reaction Center Electron Transfer Complex from Rhodobacter sphaeroides in Type I Co-Crystals
PDB Compounds: (C:) cytochrome c-2

SCOPe Domain Sequences for d1l9jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9jc_ a.3.1.1 (C:) Cytochrome c2 {Rhodobacter sphaeroides [TaxId: 1063]}
qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
avrp

SCOPe Domain Coordinates for d1l9jc_:

Click to download the PDB-style file with coordinates for d1l9jc_.
(The format of our PDB-style files is described here.)

Timeline for d1l9jc_: