| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins) |
| Protein Cytochrome c2 [46650] (8 species) |
| Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries) |
| Domain d1l9jc_: 1l9j C: [73722] Other proteins in same PDB: d1l9jh1, d1l9jh2, d1l9jl_, d1l9jm_, d1l9jr_, d1l9js_, d1l9jt1, d1l9jt2 |
PDB Entry: 1l9j (more details), 3.25 Å
SCOP Domain Sequences for d1l9jc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9jc_ a.3.1.1 (C:) Cytochrome c2 {Rhodobacter sphaeroides}
qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
avrp
Timeline for d1l9jc_: