SCOPe 2.07: Domain d1l9bm_: 1l9b M:

Lineage for d1l9bm_ (1l9b M:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (64 PDB entries)
   Uniprot P02953

8. Domain d1l9bm_: 1l9b M: [73715]
   Other proteins in same PDB: d1l9bc_, d1l9bh1, d1l9bh2, d1l9bl_
   complexed with bcl, bph, cl, fe2, hem, hto, lda, na, u10

Details for d1l9bm_

PDB Entry: 1l9b, 2.4 Å

PDB Description: X-Ray Structure of the Cytochrome-c(2)-Photosynthetic Reaction Center Electron Transfer Complex from Rhodobacter sphaeroides in Type II Co-Crystals

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d1l9bm_:

Sequence; same for both SEQRES and ATOM records:

>d1l9bm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
fstllgwfgnaqlgpiylgslgvlslfsglmwfftigiwfwyqagwnpavflrdlfffsl
eppapeyglsfaaplkegglwliasffmfvavwswwgrtylraqalgmgkhtawaflsai
wlwmvlgfirpilmgswseavpygifshldwtnnfslvhgnlfynpfhglsiaflygsal
lfamhgatilavsrfggereleqiadrgtaaeraalfwrwtmgfnatmegihrwaiwmav
lvtltggigillsgtvvdnwyvwgqnh

Timeline for d1l9bm_:

• d1l9bm_ first appeared in SCOP 1.61, called d1l9bm1
  
• d1l9bm_ appears in SCOPe 2.06
  
• d1l9bm_ appears in the current release, SCOPe 2.08