Lineage for d1l9bm_ (1l9b M:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632594Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2632595Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2632596Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2632696Protein M (medium) subunit [81481] (4 species)
  7. 2632697Species Rhodobacter sphaeroides [TaxId:1063] [81479] (64 PDB entries)
    Uniprot P02953
  8. 2632711Domain d1l9bm_: 1l9b M: [73715]
    Other proteins in same PDB: d1l9bc_, d1l9bh1, d1l9bh2, d1l9bl_
    complexed with bcl, bph, cl, fe2, hem, hto, lda, na, u10

Details for d1l9bm_

PDB Entry: 1l9b (more details), 2.4 Å

PDB Description: X-Ray Structure of the Cytochrome-c(2)-Photosynthetic Reaction Center Electron Transfer Complex from Rhodobacter sphaeroides in Type II Co-Crystals
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d1l9bm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9bm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
fstllgwfgnaqlgpiylgslgvlslfsglmwfftigiwfwyqagwnpavflrdlfffsl
eppapeyglsfaaplkegglwliasffmfvavwswwgrtylraqalgmgkhtawaflsai
wlwmvlgfirpilmgswseavpygifshldwtnnfslvhgnlfynpfhglsiaflygsal
lfamhgatilavsrfggereleqiadrgtaaeraalfwrwtmgfnatmegihrwaiwmav
lvtltggigillsgtvvdnwyvwgqnh

SCOPe Domain Coordinates for d1l9bm_:

Click to download the PDB-style file with coordinates for d1l9bm_.
(The format of our PDB-style files is described here.)

Timeline for d1l9bm_: