Domain d1l9bm_: 1l9b M:

Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)

Lineage for d1l9bm_ (1l9b M:)

Root: SCOP 1.75
Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
five transmembrane helices forming a sheet-like structure
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 protein domains)
L and M are probably related to each other
Protein M (medium) subunit [81481] (3 species)
Species Rhodobacter sphaeroides [TaxId:1063] [81479] (65 PDB entries)
Uniprot P02953
Domain d1l9bm_: 1l9b M: [73715]
Other proteins in same PDB: d1l9bc_, d1l9bh1, d1l9bh2, d1l9bl_
complexed with bcl, bph, cl, fe2, hem, hto, lda, na, u10

Details for d1l9bm_

PDB Entry: 1l9b (more details)
PDB Description: x-ray structure of the cytochrome-c(2)-photosynthetic reacti electron transfer complex from rhodobacter sphaeroides in t crystals
PDB Compounds: (M:) reaction center protein m chain

SCOP Domain Sequences for d1l9bm_:
Sequence; same for both SEQRES and ATOM records: (download)

>d1l9bm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]} fstllgwfgnaqlgpiylgslgvlslfsglmwfftigiwfwyqagwnpavflrdlfffsl eppapeyglsfaaplkegglwliasffmfvavwswwgrtylraqalgmgkhtawaflsai wlwmvlgfirpilmgswseavpygifshldwtnnfslvhgnlfynpfhglsiaflygsal lfamhgatilavsrfggereleqiadrgtaaeraalfwrwtmgfnatmegihrwaiwmav lvtltggigillsgtvvdnwyvwgqnh

SCOP Domain Coordinates for d1l9bm_:

Click to download the PDB-style file with coordinates for d1l9bm_.
(The format of our PDB-style files is described here.)

Timeline for d1l9bm_:
d1l9bm_ appears in SCOP 1.73
d1l9bm_ appears in SCOP 1.75A

d1l9bm_
(click for larger image)

d1l9bm_ in context of chain

d1l9bm_ in context of PDB
Domains from other chains:
d1l9bc_, d1l9bh1, d1l9bh2, d1l9bl_