Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) |
Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
Superfamily f.2.1: Membrane all-alpha [56869] (13 families) |
Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein) |
Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [56881] (28 PDB entries) |
Domain d1l9bm1: 1l9b M: [73715] Other proteins in same PDB: d1l9bc_, d1l9bh1 |
PDB Entry: 1l9b (more details), 2.4 Å
SCOP Domain Sequences for d1l9bm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9bm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides} fstllgwfgnaqlgpiylgslgvlslfsglmwfftigiwfwyqagwnpavflrdlfffsl eppapeyglsfaaplkegglwliasffmfvavwswwgrtylraqalgmgkhtawaflsai wlwmvlgfirpilmgswseavpygifshldwtnnfslvhgnlfynpfhglsiaflygsal lfamhgatilavsrfggereleqiadrgtaaeraalfwrwtmgfnatmegihrwaiwmav lvtltggigillsgtvvdnwyvwgqnh
Timeline for d1l9bm1:
View in 3D Domains from other chains: (mouse over for more information) d1l9bc_, d1l9bh1, d1l9bh2, d1l9bl1 |