SCOP 1.69: Domain d1l9bl_: 1l9b L:

Lineage for d1l9bl_ (1l9b L:)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (39 PDB entries)

8. Domain d1l9bl_: 1l9b L: [73714]
   Other proteins in same PDB: d1l9bc_, d1l9bh1, d1l9bh2, d1l9bm_

Details for d1l9bl_

PDB Entry: 1l9b, 2.4 Å

PDB Description: X-Ray Structure of the Cytochrome-c(2)-Photosynthetic Reaction Center Electron Transfer Complex from Rhodobacter sphaeroides in Type II Co-Crystals

SCOP Domain Sequences for d1l9bl_:

Sequence; same for both SEQRES and ATOM records:

>d1l9bl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d1l9bl_:

• d1l9bl_ first appeared in SCOP 1.61, called d1l9bl1
  
• d1l9bl_ appears in SCOP 1.67
  
• d1l9bl_ appears in SCOP 1.71
  
• d1l9bl_ appears in the current release, SCOPe 2.08