Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)
Search SCOP (example):

Lineage for d1l9bh1 (1l9b H:36-253)

  1. Root: SCOP 1.75
  2. Class b: All beta proteins [48724] (174 folds)
  3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. Superfamily b.41.1: PRC-barrel domain [50346] (4 families) (S)
  5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. Protein Photosynthetic reaction centre [50348] (3 species)
  7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (39 PDB entries)
    Uniprot P11846
  8. Domain d1l9bh1: 1l9b H:36-253 [73712]
    Other proteins in same PDB: d1l9bc_, d1l9bh2, d1l9bl_, d1l9bm_
    complexed with bcl, bph, cl, fe2, hem, hto, lda, na, u10

Details for d1l9bh1

PDB Entry: 1l9b (more details)
PDB Description: x-ray structure of the cytochrome-c(2)-photosynthetic reacti electron transfer complex from rhodobacter sphaeroides in t crystals
PDB Compounds: (H:) reaction center protein h chain

SCOP Domain Sequences for d1l9bh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9bh1 b.41.1.1 (H:36-253) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvva

SCOP Domain Coordinates for d1l9bh1:

Click to download the PDB-style file with coordinates for d1l9bh1.
(The format of our PDB-style files is described here.)

Timeline for d1l9bh1:

d1l9bh1 appears in SCOP 1.73
d1l9bh1 appears in SCOP 1.75A


d1l9bh1
(click for larger image)


d1l9bh1 in context of chain
Domains from same chain:
d1l9bh2


d1l9bh1 in context of PDB
Domains from other chains:
d1l9bc_, d1l9bl_, d1l9bm_


SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu