SCOP 1.61: Domain d1l9bc_: 1l9b C:

Lineage for d1l9bc_ (1l9b C:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)

4. Superfamily a.3.1: Cytochrome c [46626] (7 families)

5. Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)

6. Protein Cytochrome c2 [46650] (8 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries)

8. Domain d1l9bc_: 1l9b C: [73711]
   Other proteins in same PDB: d1l9bh1, d1l9bh2, d1l9bl1, d1l9bm1

Details for d1l9bc_

PDB Entry: 1l9b, 2.4 Å

PDB Description: X-Ray Structure of the Cytochrome-c(2)-Photosynthetic Reaction Center Electron Transfer Complex from Rhodobacter sphaeroides in Type II Co-Crystals

SCOP Domain Sequences for d1l9bc_:

Sequence; same for both SEQRES and ATOM records:

>d1l9bc_ a.3.1.1 (C:) Cytochrome c2 {Rhodobacter sphaeroides}
qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
avrp

Timeline for d1l9bc_:

• d1l9bc_ is new in SCOP 1.61
  
• d1l9bc_ appears in SCOP 1.63
  
• d1l9bc_ appears in the current release, SCOPe 2.08