Lineage for d1l9bc_ (1l9b C:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149460Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 149461Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 149462Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 149466Protein Cytochrome c2 [46650] (8 species)
  7. 149474Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries)
  8. 149479Domain d1l9bc_: 1l9b C: [73711]
    Other proteins in same PDB: d1l9bh1, d1l9bh2, d1l9bl1, d1l9bm1

Details for d1l9bc_

PDB Entry: 1l9b (more details), 2.4 Å

PDB Description: X-Ray Structure of the Cytochrome-c(2)-Photosynthetic Reaction Center Electron Transfer Complex from Rhodobacter sphaeroides in Type II Co-Crystals

SCOP Domain Sequences for d1l9bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9bc_ a.3.1.1 (C:) Cytochrome c2 {Rhodobacter sphaeroides}
qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
avrp

SCOP Domain Coordinates for d1l9bc_:

Click to download the PDB-style file with coordinates for d1l9bc_.
(The format of our PDB-style files is described here.)

Timeline for d1l9bc_: