Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1l9bc_ (1l9b C:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)
  6. Protein Cytochrome c2 [46650] (8 species)
  7. Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries)
  8. Domain d1l9bc_: 1l9b C: [73711]
    Other proteins in same PDB: d1l9bh1, d1l9bh2, d1l9bl_, d1l9bm_
    complexed with bcl, bph, cl, fe2, hem, hto, lda, na, u10

Details for d1l9bc_

PDB Entry: 1l9b (more details)
PDB Description: x-ray structure of the cytochrome-c(2)-photosynthetic reacti electron transfer complex from rhodobacter sphaeroides in t crystals
PDB Compounds: (C:) cytochrome c-2

SCOP Domain Sequences for d1l9bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9bc_ a.3.1.1 (C:) Cytochrome c2 {Rhodobacter sphaeroides [TaxId: 1063]}
qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
avrp

SCOP Domain Coordinates for d1l9bc_:

Click to download the PDB-style file with coordinates for d1l9bc_.
(The format of our PDB-style files is described here.)

Timeline for d1l9bc_:

d1l9bc_ appears in SCOP 1.75A


d1l9bc_
(click for larger image)


d1l9bc_ in context of chain



d1l9bc_ in context of PDB
Domains from other chains:
d1l9bh1, d1l9bh2, d1l9bl_, d1l9bm_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu