SCOPe 2.03: Domain d1l9aa_: 1l9a A:

Lineage for d1l9aa_ (1l9a A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.201: SRP19 [69694] (1 superfamily)
   beta-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.201.1: SRP19 [69695] (2 families)
   automatically mapped to Pfam PF01922

5. Family d.201.1.1: SRP19 [69696] (1 protein)

6. Protein SRP19 [69697] (3 species)

7. Species Methanococcus jannaschii [TaxId:2190] [75417] (3 PDB entries)

8. Domain d1l9aa_: 1l9a A: [73710]
   protein/RNA complex; complexed with mg, mmc

Details for d1l9aa_

PDB Entry: 1l9a, 2.9 Å

PDB Description: crystal structure of srp19 in complex with the s domain of signal recognition particle rna

PDB Compounds: (A:) signal recognition particle 19 kda protein

SCOPe Domain Sequences for d1l9aa_:

Sequence; same for both SEQRES and ATOM records:

>d1l9aa_ d.201.1.1 (A:) SRP19 {Methanococcus jannaschii [TaxId: 2190]}
miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
agrvevdykgnklcllkeiakiikgkn

Timeline for d1l9aa_:

• d1l9aa_ first appeared in SCOP 1.61
  
• d1l9aa_ appears in SCOPe 2.02
  
• d1l9aa_ appears in SCOPe 2.04
  
• d1l9aa_ appears in the current release, SCOPe 2.08