Lineage for d1l8za_ (1l8z A:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.21: HMG-box [47094] (1 superfamily) Superfamily a.21.1: HMG-box [47095] (1 family) 
Family a.21.1.1: HMG-box [47096] (8 proteins) 
Protein Upstream binding factor [68982] (1 species) Species Human (Homo sapiens) [TaxId:9606] [68983] (3 PDB entries) 
Domain d1l8za_: 1l8z A: [73709]
Details for d1l8za_
PDB Entry: 1l8z (more details)
PDB Description: solution structure of hmg box 5 in human upstream binding factor
SCOP Domain Sequences for d1l8za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l8za_ a.21.1.1 (A:) Upstream binding factor {Human (Homo sapiens)}
gklpespkraeeiwqqsvigdylarfkndrvkalkamemtwnnmekkeklmwikkaaedq
kryerelsemrappaatnsskkle
SCOP Domain Coordinates for d1l8za_:
Click to download the PDB-style file with coordinates for d1l8za_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l8za_:
- d1l8za_ is new in SCOP 1.61
- d1l8za_ appears in SCOP 1.63
- d1l8za_ appears in the current release, SCOPe 2.08, called d1l8za1
View in 3D