Lineage for d1l8za_ (1l8z A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151015Fold a.21: HMG-box [47094] (1 superfamily)
  4. 151016Superfamily a.21.1: HMG-box [47095] (1 family) (S)
  5. 151017Family a.21.1.1: HMG-box [47096] (8 proteins)
  6. 151053Protein Upstream binding factor [68982] (1 species)
  7. 151054Species Human (Homo sapiens) [TaxId:9606] [68983] (3 PDB entries)
  8. 151057Domain d1l8za_: 1l8z A: [73709]

Details for d1l8za_

PDB Entry: 1l8z (more details)

PDB Description: Solution structure of HMG box 5 in human upstream binding factor

SCOP Domain Sequences for d1l8za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8za_ a.21.1.1 (A:) Upstream binding factor {Human (Homo sapiens)}
gklpespkraeeiwqqsvigdylarfkndrvkalkamemtwnnmekkeklmwikkaaedq
kryerelsemrappaatnsskkle

SCOP Domain Coordinates for d1l8za_:

Click to download the PDB-style file with coordinates for d1l8za_.
(The format of our PDB-style files is described here.)

Timeline for d1l8za_: