SCOPe 2.08: Domain d1l8za1: 1l8z A:1-82

Lineage for d1l8za1 (1l8z A:1-82)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.1: HMG-box [47096] (10 proteins)

6. Protein Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) [68982] (2 species)
   Contains 6 HMG-box domains

7. Species Human (Homo sapiens) [TaxId:9606] [68983] (3 PDB entries)

8. Domain d1l8za1: 1l8z A:1-82 [73709]
   Other proteins in same PDB: d1l8za2
   HMG box 5

Details for d1l8za1

PDB Entry: 1l8z

PDB Description: solution structure of hmg box 5 in human upstream binding factor

PDB Compounds: (A:) Upstream binding factor 1

SCOPe Domain Sequences for d1l8za1:

Sequence; same for both SEQRES and ATOM records:

>d1l8za1 a.21.1.1 (A:1-82) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]}
gklpespkraeeiwqqsvigdylarfkndrvkalkamemtwnnmekkeklmwikkaaedq
kryerelsemrappaatnsskk

Timeline for d1l8za1:

• d1l8za1 first appeared in SCOP 1.61, called d1l8za_
  
• d1l8za1 appears in SCOPe 2.07