Lineage for d1l8ya1 (1l8y A:1-82)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311321Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2311322Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2311323Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 2311355Protein Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) [68982] (2 species)
    Contains 6 HMG-box domains
  7. 2311356Species Human (Homo sapiens) [TaxId:9606] [68983] (3 PDB entries)
  8. 2311358Domain d1l8ya1: 1l8y A:1-82 [73708]
    Other proteins in same PDB: d1l8ya2
    HMG box 5

Details for d1l8ya1

PDB Entry: 1l8y (more details)

PDB Description: solution structure of hmg box 5 in human upstream binding factor
PDB Compounds: (A:) Upstream binding factor 1

SCOPe Domain Sequences for d1l8ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8ya1 a.21.1.1 (A:1-82) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]}
gklpespkraeeiwqqsvigdylarfkndrvkalkamemtwnnmekkeklmwikkaaedq
kryerelsemrappaatnsskk

SCOPe Domain Coordinates for d1l8ya1:

Click to download the PDB-style file with coordinates for d1l8ya1.
(The format of our PDB-style files is described here.)

Timeline for d1l8ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l8ya2