Lineage for d1l8wb_ (1l8w B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 157342Fold a.154: Variable surface antigen VlsE [74747] (1 superfamily)
  4. 157343Superfamily a.154.1: Variable surface antigen VlsE [74748] (1 family) (S)
  5. 157344Family a.154.1.1: Variable surface antigen VlsE [74749] (1 protein)
  6. 157345Protein Variable surface antigen VlsE [74750] (1 species)
  7. 157346Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [74751] (1 PDB entry)
  8. 157348Domain d1l8wb_: 1l8w B: [73705]

Details for d1l8wb_

PDB Entry: 1l8w (more details), 2.3 Å

PDB Description: crystal structure of lyme disease variable surface antigen vlse of borrelia burgdorferi

SCOP Domain Sequences for d1l8wb_:

Sequence, based on SEQRES records: (download)

>d1l8wb_ a.154.1.1 (B:) Variable surface antigen VlsE {Lyme disease spirochete (Borrelia burgdorferi)}
ptnkfyqsviqlgngfldvftsfgglvaeafgfksdpkksdvktyfttvaaklektktdl
nslpkeksdissttgkpdstgsvgtavegaikevselldklvkavktaegassgtaaige
vvadadaakvadkasvkgiakgikeiveaaggseklkavaaakgennkgagklfgkagaa
ahgdseaaskaagavsavsgeqilsaivtaadaaeqdgkkpeeaknpiaaaigdkdggae
fgqdemkkddqiaaaialrgmakdgkfavkdgekekaegaikgaaesavrkvlgaitgli
gdavssglrkvgdsvk

Sequence, based on observed residues (ATOM records): (download)

>d1l8wb_ a.154.1.1 (B:) Variable surface antigen VlsE {Lyme disease spirochete (Borrelia burgdorferi)}
ptnkfyqsviqlgngfldvftsfgglvaeafgfksdpkksdvktyfttvaaklektktdl
nslptavegaikevselldklvkavktaegassgtaaigevvadadaakvadkasvkgia
kgikeiveaaggseklkavaaakgennkgagklfgkagaaahgdseaaskaagavsavsg
eqilsaivtaadaaeqdgkkpeeaknpiaaaigdkdggaefgqdemkkddqiaaaialrg
makdgkfavkdgekekaegaikgaaesavrkvlgaitgligdavssglrkvgdsvk

SCOP Domain Coordinates for d1l8wb_:

Click to download the PDB-style file with coordinates for d1l8wb_.
(The format of our PDB-style files is described here.)

Timeline for d1l8wb_: