Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.6: Aminoglycoside phosphotransferases [64411] (2 proteins) |
Protein Type IIIa 3',5"-aminoglycoside phosphotransferase [64412] (1 species) |
Species Enterococcus faecalis [TaxId:1351] [64413] (5 PDB entries) |
Domain d1l8ua_: 1l8u A: [73703] complexed with adp, mg, nmy |
PDB Entry: 1l8u (more details), 2.7 Å
SCOP Domain Sequences for d1l8ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l8ua_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis} akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf fdllgikpdwekikyyilldelf
Timeline for d1l8ua_: