Lineage for d1l8ua_ (1l8u A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611837Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 611838Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 611865Family d.144.1.6: Aminoglycoside phosphotransferases [64411] (2 proteins)
  6. 611870Protein Type IIIa 3',5"-aminoglycoside phosphotransferase [64412] (1 species)
  7. 611871Species Enterococcus faecalis [TaxId:1351] [64413] (5 PDB entries)
  8. 611877Domain d1l8ua_: 1l8u A: [73703]
    complexed with adp, mg, nmy

Details for d1l8ua_

PDB Entry: 1l8u (more details), 2.7 Å

PDB Description: Crystal Structure Of 3',5"-Aminoglycoside Phosphotransferase Type IIIa ADP Neomycin B Complex

SCOP Domain Sequences for d1l8ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8ua_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis}
akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek
dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl
fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe
eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf
fdllgikpdwekikyyilldelf

SCOP Domain Coordinates for d1l8ua_:

Click to download the PDB-style file with coordinates for d1l8ua_.
(The format of our PDB-style files is described here.)

Timeline for d1l8ua_: