Lineage for d1l8ra_ (1l8r A:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) Superfamily a.6.1: Putative DNA-binding domain [46955] (5 families) 
Family a.6.1.4: Retinal determination protein Dachshund [74693] (1 protein) Protein Retinal determination protein Dachshund [74694] (1 species) Species Human (Homo sapiens) [TaxId:9606] [74695] (1 PDB entry) 
Domain d1l8ra_: 1l8r A: [73700]
Details for d1l8ra_
PDB Entry: 1l8r (more details), 1.65 Å
PDB Description: Structure of the Retinal Determination Protein Dachshund Reveals a DNA-Binding Motif
SCOP Domain Sequences for d1l8ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l8ra_ a.6.1.4 (A:) Retinal determination protein Dachshund {Human (Homo sapiens)}
gsqnneckmvdlrgakvasftvegceliclpqafdlflkhlvgglhtvytklkrleitpv
vcnveqvrilrglgaiqpgvnrcklisrkdfetlyndctna
SCOP Domain Coordinates for d1l8ra_:
Click to download the PDB-style file with coordinates for d1l8ra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l8ra_:
- d1l8ra_ is new in SCOP 1.61
- d1l8ra_ appears in SCOP 1.63
- d1l8ra_ appears in the current release, SCOPe 2.07, called d1l8ra1
View in 3D
