Lineage for d1l8ra_ (1l8r A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 150662Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
  4. 150663Superfamily a.6.1: Putative DNA-binding domain [46955] (5 families) (S)
  5. 150690Family a.6.1.4: Retinal determination protein Dachshund [74693] (1 protein)
  6. 150691Protein Retinal determination protein Dachshund [74694] (1 species)
  7. 150692Species Human (Homo sapiens) [TaxId:9606] [74695] (1 PDB entry)
  8. 150693Domain d1l8ra_: 1l8r A: [73700]

Details for d1l8ra_

PDB Entry: 1l8r (more details), 1.65 Å

PDB Description: Structure of the Retinal Determination Protein Dachshund Reveals a DNA-Binding Motif

SCOP Domain Sequences for d1l8ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8ra_ a.6.1.4 (A:) Retinal determination protein Dachshund {Human (Homo sapiens)}
gsqnneckmvdlrgakvasftvegceliclpqafdlflkhlvgglhtvytklkrleitpv
vcnveqvrilrglgaiqpgvnrcklisrkdfetlyndctna

SCOP Domain Coordinates for d1l8ra_:

Click to download the PDB-style file with coordinates for d1l8ra_.
(The format of our PDB-style files is described here.)

Timeline for d1l8ra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1l8rb_