Lineage for d1l8pc2 (1l8p C:1001-1141)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412715Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1412760Protein Enolase [54828] (9 species)
  7. 1412761Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (16 PDB entries)
  8. 1412779Domain d1l8pc2: 1l8p C:1001-1141 [73697]
    Other proteins in same PDB: d1l8pa1, d1l8pb1, d1l8pc1, d1l8pd1
    complexed with mg, pah

Details for d1l8pc2

PDB Entry: 1l8p (more details), 2.1 Å

PDB Description: mg-phosphonoacetohydroxamate complex of s39a yeast enolase 1
PDB Compounds: (C:) enolase 1

SCOPe Domain Sequences for d1l8pc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8pc2 d.54.1.1 (C:1001-1141) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgaatgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOPe Domain Coordinates for d1l8pc2:

Click to download the PDB-style file with coordinates for d1l8pc2.
(The format of our PDB-style files is described here.)

Timeline for d1l8pc2: