SCOP 1.65: Domain d1l8ka_: 1l8k A:

Lineage for d1l8ka_ (1l8k A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1432

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (8 species)

7. Species Human (Homo sapiens), T-cell [TaxId:9606] [75233] (1 PDB entry)
   non-receptor type 2

8. Domain d1l8ka_: 1l8k A: [73691]

Details for d1l8ka_

PDB Entry: 1l8k, 2.56 Å

PDB Description: T Cell Protein-Tyrosine Phosphatase Structure

SCOP Domain Sequences for d1l8ka_:

Sequence; same for both SEQRES and ATOM records:

>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell}
ierefeeldtqrrwqplyleirneshdyphrvakfpenrnrnryrdvspydhsrvklqna
endyinaslvdieeaqrsyiltqgplpntcchfwlmvwqqktkavvmlnrivekesvkca
qywptddqemlfketgfsvkllsedvksyytvhllqleninsgetrtishfhyttwpdfg
vpespasflnflfkvresgslnpdhgpavihcsagigrsgtfslvdtclvlmekgddini
kqvllnmrkyrmgliqtpdqlrfsymaiiegak

Timeline for d1l8ka_:

• d1l8ka_ first appeared in SCOP 1.61
  
• d1l8ka_ appears in SCOP 1.63
  
• d1l8ka_ appears in SCOP 1.67
  
• d1l8ka_ appears in the current release, SCOPe 2.08