Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1432 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
Protein Tyrosine phosphatase [52806] (8 species) |
Species Human (Homo sapiens), T-cell [TaxId:9606] [75233] (1 PDB entry) non-receptor type 2 |
Domain d1l8ka_: 1l8k A: [73691] |
PDB Entry: 1l8k (more details), 2.56 Å
SCOP Domain Sequences for d1l8ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell} ierefeeldtqrrwqplyleirneshdyphrvakfpenrnrnryrdvspydhsrvklqna endyinaslvdieeaqrsyiltqgplpntcchfwlmvwqqktkavvmlnrivekesvkca qywptddqemlfketgfsvkllsedvksyytvhllqleninsgetrtishfhyttwpdfg vpespasflnflfkvresgslnpdhgpavihcsagigrsgtfslvdtclvlmekgddini kqvllnmrkyrmgliqtpdqlrfsymaiiegak
Timeline for d1l8ka_: