Lineage for d1l8ja_ (1l8j A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255226Protein Endothelial protein C receptor [75381] (1 species)
    phospholipid-binding protein
  7. 255227Species Human (Homo sapiens) [TaxId:9606] [75382] (2 PDB entries)
  8. 255230Domain d1l8ja_: 1l8j A: [73690]
    complexed with a phospholipid molecule
    complexed with nag, pty

Details for d1l8ja_

PDB Entry: 1l8j (more details), 2 Å

PDB Description: crystal structure of the endothelial protein c receptor and bound phospholipid molecule

SCOP Domain Sequences for d1l8ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8ja_ d.19.1.1 (A:) Endothelial protein C receptor {Human (Homo sapiens)}
lqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartqs
glqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsfr
peralwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhi

SCOP Domain Coordinates for d1l8ja_:

Click to download the PDB-style file with coordinates for d1l8ja_.
(The format of our PDB-style files is described here.)

Timeline for d1l8ja_: