Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
Protein Endothelial protein C receptor [75381] (1 species) phospholipid-binding protein |
Species Human (Homo sapiens) [TaxId:9606] [75382] (2 PDB entries) |
Domain d1l8ja_: 1l8j A: [73690] complexed with a phospholipid molecule complexed with nag, pty |
PDB Entry: 1l8j (more details), 2 Å
SCOP Domain Sequences for d1l8ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l8ja_ d.19.1.1 (A:) Endothelial protein C receptor {Human (Homo sapiens)} lqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartqs glqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsfr peralwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhi
Timeline for d1l8ja_: