SCOP 1.67: Domain d1l8ga_: 1l8g A:

Lineage for d1l8ga_ (1l8g A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (5 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (7 species)

7. Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (58 PDB entries)

8. Domain d1l8ga_: 1l8g A: [73689]
   complexed with dbd

Details for d1l8ga_

PDB Entry: 1l8g, 2.5 Å

PDB Description: Crystal structure of PTP1B complexed with 7-(1,1-Dioxo-1H-benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7-dihydro-5H-thieno[2,3-c]pyran-3-carboxylic acid

SCOP Domain Sequences for d1l8ga_:

Sequence; same for both SEQRES and ATOM records:

>d1l8ga_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediktyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvlldmrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed

Timeline for d1l8ga_:

• d1l8ga_ first appeared in SCOP 1.61
  
• d1l8ga_ appears in SCOP 1.65
  
• d1l8ga_ appears in SCOP 1.69
  
• d1l8ga_ appears in the current release, SCOPe 2.08