Lineage for d1l8cb_ (1l8c B:)

  1. Root: SCOP 1.65
  2. 347435Class j: Peptides [58231] (105 folds)
  3. 348727Fold j.96: Transactivation domain [81275] (1 superfamily)
  4. 348728Superfamily j.96.1: Transactivation domain [74800] (1 family) (S)
  5. 348729Family j.96.1.1: Transactivation domain [74801] (2 proteins)
  6. 348730Protein C-terminal activation domain (CTAD) of HIF-1alpha [74802] (1 species)
  7. 348731Species Human (Homo sapiens) [TaxId:9606] [74803] (4 PDB entries)
  8. 348734Domain d1l8cb_: 1l8c B: [73686]
    Other proteins in same PDB: d1l8ca_
    complexed with TAZ1 domain of mouse CBP
    complexed with zn

Details for d1l8cb_

PDB Entry: 1l8c (more details)

PDB Description: structural basis for hif-1alpha/cbp recognition in the cellular hypoxic response

SCOP Domain Sequences for d1l8cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8cb_ j.96.1.1 (B:) C-terminal activation domain (CTAD) of HIF-1alpha {Human (Homo sapiens)}
sdlacrllgqsmdesglpqltsydcevnapiqgsrnllqgeellraldqvn

SCOP Domain Coordinates for d1l8cb_:

Click to download the PDB-style file with coordinates for d1l8cb_.
(The format of our PDB-style files is described here.)

Timeline for d1l8cb_:

348734
d1l8cb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1l8ca_