SCOP 1.61: Domain d1l8cb_: 1l8c B:

Lineage for d1l8cb_ (1l8c B:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)

4. Superfamily a.137.10: C-terminal activation domain (CTAD) of HIF-1alpha [74800] (1 family)

5. Family a.137.10.1: C-terminal activation domain (CTAD) of HIF-1alpha [74801] (1 protein)

6. Protein C-terminal activation domain (CTAD) of HIF-1alpha [74802] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74803] (2 PDB entries)

8. Domain d1l8cb_: 1l8c B: [73686]
   Other proteins in same PDB: d1l8ca_

Details for d1l8cb_

PDB Entry: 1l8c

PDB Description: structural basis for hif-1alpha/cbp recognition in the cellular hypoxic response

SCOP Domain Sequences for d1l8cb_:

Sequence; same for both SEQRES and ATOM records:

>d1l8cb_ a.137.10.1 (B:) C-terminal activation domain (CTAD) of HIF-1alpha {Human (Homo sapiens)}
sdlacrllgqsmdesglpqltsydcevnapiqgsrnllqgeellraldqvn

Timeline for d1l8cb_:

• d1l8cb_ is new in SCOP 1.61
  
• d1l8cb_ appears in SCOP 1.63
  
• d1l8cb_ appears in the current release, SCOPe 2.08