SCOP 1.69: Domain d1l8ca_: 1l8c A:

Lineage for d1l8ca_ (1l8c A:)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.53: TAZ domain [57932] (1 superfamily)
   all-alpha fold; Zn-binding sites are in the loops connecting helices

4. Superfamily g.53.1: TAZ domain [57933] (1 family)

5. Family g.53.1.1: TAZ domain [57934] (1 protein)

6. Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57936] (2 PDB entries)

8. Domain d1l8ca_: 1l8c A: [73685]
   Other proteins in same PDB: d1l8cb_
   TAZ1 domain; complexed with the C-terminal activation domain (CTAD) of human HIF-1alpha (chain B)

Details for d1l8ca_

PDB Entry: 1l8c

PDB Description: structural basis for hif-1alpha/cbp recognition in the cellular hypoxic response

SCOP Domain Sequences for d1l8ca_:

Sequence; same for both SEQRES and ATOM records:

>d1l8ca_ g.53.1.1 (A:) CREB-binding transcriptional adaptor protein CBP (p300) {Mouse (Mus musculus)}
adpekrkliqqqlvlllhahkcqrreqangevracslphcrtmknvlnhmthcqagkacq
vahcassrqiishwknctrhdcpvclplknasdkr

Timeline for d1l8ca_:

• d1l8ca_ first appeared in SCOP 1.61
  
• d1l8ca_ appears in SCOP 1.67
  
• d1l8ca_ appears in SCOP 1.71
  
• d1l8ca_ appears in the current release, SCOPe 2.08