![]() | Class g: Small proteins [56992] (75 folds) |
![]() | Fold g.53: TAZ domain [57932] (1 superfamily) all-alpha fold; Zn-binding sites are in the loops connecting helices |
![]() | Superfamily g.53.1: TAZ domain [57933] (1 family) ![]() |
![]() | Family g.53.1.1: TAZ domain [57934] (1 protein) |
![]() | Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [57936] (2 PDB entries) |
![]() | Domain d1l8ca_: 1l8c A: [73685] Other proteins in same PDB: d1l8cb_ TAZ1 domain; complexed with the C-terminal activation domain (CTAD) of human HIF-1alpha (chain B) |
PDB Entry: 1l8c (more details)
SCOP Domain Sequences for d1l8ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l8ca_ g.53.1.1 (A:) CREB-binding transcriptional adaptor protein CBP (p300) {Mouse (Mus musculus)} adpekrkliqqqlvlllhahkcqrreqangevracslphcrtmknvlnhmthcqagkacq vahcassrqiishwknctrhdcpvclplknasdkr
Timeline for d1l8ca_: