SCOPe 2.06: Domain d1l8bb_: 1l8b B:

Lineage for d1l8bb_ (1l8b B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.86: eIF4e-like [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: eIF4e-like [55418] (3 families)

5. Family d.86.1.1: Translation initiation factor eIF4e [55419] (2 proteins)
   automatically mapped to Pfam PF01652

6. Protein Translation initiation factor eIF4e [55420] (3 species)
   messenger RNA 5' cap-binding protein

7. Species Mouse (Mus musculus) [TaxId:10090] [55421] (15 PDB entries)

8. Domain d1l8bb_: 1l8b B: [73684]
   complexed with mgp

Details for d1l8bb_

PDB Entry: 1l8b, 1.8 Å

PDB Description: cocrystal structure of the messenger rna 5' cap-binding protein (eif4e) bound to 7-methylgpppg

PDB Compounds: (B:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d1l8bb_:

Sequence; same for both SEQRES and ATOM records:

>d1l8bb_ d.86.1.1 (B:) Translation initiation factor eIF4e {Mouse (Mus musculus) [TaxId: 10090]}
vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
gsttknrfvv

Timeline for d1l8bb_:

• d1l8bb_ first appeared in SCOP 1.61
  
• d1l8bb_ appears in SCOPe 2.05
  
• d1l8bb_ appears in SCOPe 2.07
  
• d1l8bb_ appears in the current release, SCOPe 2.08