Lineage for d1l8aa3 (1l8a A:701-886)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. Protein Pyruvate dehydrogenase E1 component, C-domain [75239] (1 species)
    E1A and E1B fused together in a single-chain protein
  7. Species Escherichia coli [TaxId:562] [75240] (8 PDB entries)
  8. Domain d1l8aa3: 1l8a A:701-886 [73679]
    Other proteins in same PDB: d1l8aa1, d1l8aa2, d1l8ab1, d1l8ab2
    complexed with mg, tdp

Details for d1l8aa3

PDB Entry: 1l8a (more details), 1.85 Å

PDB Description: e. coli pyruvate dehydrogenase
PDB Compounds: (A:) Pyruvate dehydrogenase E1 component

SCOPe Domain Sequences for d1l8aa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8aa3 c.48.1.1 (A:701-886) Pyruvate dehydrogenase E1 component, C-domain {Escherichia coli [TaxId: 562]}
mpegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvts
ftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddy
rvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadk
vnprla

SCOPe Domain Coordinates for d1l8aa3 are not available.

Timeline for d1l8aa3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l8aa1, d1l8aa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1l8ab1, d1l8ab2, d1l8ab3