Lineage for d1l7na_ (1l7n A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186865Fold c.108: HAD-like [56783] (1 superfamily)
  4. 186866Superfamily c.108.1: HAD-like [56784] (6 families) (S)
  5. 186901Family c.108.1.4: Phosphoserine phosphatase [64511] (1 protein)
  6. 186902Protein Phosphoserine phosphatase [64512] (1 species)
  7. 186903Species Archaeon Methanococcus jannaschii [TaxId:2190] [64513] (6 PDB entries)
  8. 186908Domain d1l7na_: 1l7n A: [73666]

Details for d1l7na_

PDB Entry: 1l7n (more details), 1.8 Å

PDB Description: transition state analogue of phosphoserine phosphatase (aluminum fluoride complex)

SCOP Domain Sequences for d1l7na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l7na_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii}
kkkklilfdfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsllkd
lpiekvekaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafanr
livkdgkltgdvegevlkenakgeilekiakieginledtvavgdgandismfkkaglki
afcakpilkekadiciekrdlreilkyik

SCOP Domain Coordinates for d1l7na_:

Click to download the PDB-style file with coordinates for d1l7na_.
(The format of our PDB-style files is described here.)

Timeline for d1l7na_: