SCOPe 2.08: Domain d1l7mb_: 1l7m B:

Lineage for d1l7mb_ (1l7m B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.4: Phosphoserine phosphatase [64511] (1 protein)
   the insertion subdomain is a 4-helical bundle
   automatically mapped to Pfam PF06888
   automatically mapped to Pfam PF12710

6. Protein Phosphoserine phosphatase [64512] (2 species)

7. Species Methanococcus jannaschii [TaxId:2190] [64513] (6 PDB entries)

8. Domain d1l7mb_: 1l7m B: [73665]
   PI complex
   complexed with mg, po4

Details for d1l7mb_

PDB Entry: 1l7m, 1.48 Å

PDB Description: high resolution liganded structure of phosphoserine phosphatase (pi complex)

PDB Compounds: (B:) Phosphoserine Phosphatase

SCOPe Domain Sequences for d1l7mb_:

Sequence; same for both SEQRES and ATOM records:

>d1l7mb_ c.108.1.4 (B:) Phosphoserine phosphatase {Methanococcus jannaschii [TaxId: 2190]}
ekkkklilfdfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsllk
dlpiekvekaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafan
rlivkdgkltgdvegevlkenakgeilekiakieginledtvavgdgandismfkkaglk
iafcakpilkekadiciekrdlreilkyik

Timeline for d1l7mb_:

• d1l7mb_ first appeared in SCOP 1.61
  
• d1l7mb_ appears in SCOPe 2.07