Lineage for d1l7ma_ (1l7m A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.108: HAD-like [56783] (1 superfamily) Superfamily c.108.1: HAD-like [56784] (6 families) 
Family c.108.1.4: Phosphoserine phosphatase [64511] (1 protein) Protein Phosphoserine phosphatase [64512] (1 species) Species Archaeon Methanococcus jannaschii [TaxId:2190] [64513] (6 PDB entries) 
Domain d1l7ma_: 1l7m A: [73664]
Details for d1l7ma_
PDB Entry: 1l7m (more details), 1.48 Å
PDB Description: high resolution liganded structure of phosphoserine phosphatase (pi complex)
SCOP Domain Sequences for d1l7ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l7ma_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii}
kkkklilfdfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsllkd
lpiekvekaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafanr
livkdgkltgdvegevlkenakgeilekiakieginledtvavgdgandismfkkaglki
afcakpilkekadiciekrdlreilkyik
SCOP Domain Coordinates for d1l7ma_:
Click to download the PDB-style file with coordinates for d1l7ma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l7ma_:
- d1l7ma_ is new in SCOP 1.61
- d1l7ma_ appears in SCOP 1.63
- d1l7ma_ appears in the current release, SCOPe 2.08
View in 3D
