SCOP 1.65: Domain d1l7ih2: 1l7i H:114-216

Lineage for d1l7ih2 (1l7i H:114-216)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (63 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1l7ih2: 1l7i H:114-216 [73657]
   Other proteins in same PDB: d1l7ih1, d1l7il1, d1l7il2
   part of humanized anti-ERBb2 Fab 2C4
   complexed with so4

Details for d1l7ih2

PDB Entry: 1l7i, 1.8 Å

PDB Description: Crystal Structure of the anti-ErbB2 Fab2C4

SCOP Domain Sequences for d1l7ih2:

Sequence; same for both SEQRES and ATOM records:

>d1l7ih2 b.1.1.2 (H:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d1l7ih2:

• d1l7ih2 first appeared in SCOP 1.61
  
• d1l7ih2 appears in SCOP 1.63
  
• d1l7ih2 appears in SCOP 1.67
  
• d1l7ih2 appears in the current release, SCOPe 2.08