Lineage for d1l7fa_ (1l7f A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170568Fold b.68: 6-bladed beta-propeller [50938] (7 superfamilies)
  4. 170569Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 170570Family b.68.1.1: Sialidases (neuraminidases) [50940] (6 proteins)
  6. 170571Protein Influenza neuraminidase [50943] (2 species)
  7. 170572Species Influenza A virus, different strains [TaxId:11320] [50944] (48 PDB entries)
  8. 170577Domain d1l7fa_: 1l7f A: [73653]

Details for d1l7fa_

PDB Entry: 1l7f (more details), 1.8 Å

PDB Description: Crystal structure of influenza virus neuraminidase in complex with BCX-1812

SCOP Domain Sequences for d1l7fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l7fa_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains}
rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwdwpdgakieyfl

SCOP Domain Coordinates for d1l7fa_:

Click to download the PDB-style file with coordinates for d1l7fa_.
(The format of our PDB-style files is described here.)

Timeline for d1l7fa_: