Lineage for d1l7cc1 (1l7c C:393-507)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1726514Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1726956Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 1726957Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 1726958Protein alpha-catenin [47222] (2 species)
  7. 1726964Species Mouse (Mus musculus) [TaxId:10090] [47223] (3 PDB entries)
  8. 1726969Domain d1l7cc1: 1l7c C:393-507 [73651]
    CASP4

Details for d1l7cc1

PDB Entry: 1l7c (more details), 2.5 Å

PDB Description: alpha-catenin fragment, residues 385-651
PDB Compounds: (C:) Alpha E-catenin

SCOPe Domain Sequences for d1l7cc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l7cc1 a.24.9.1 (C:393-507) alpha-catenin {Mouse (Mus musculus) [TaxId: 10090]}
sfletnvpllvlieaakngnekevkeyaqvfrehanklievanlacsisnneegvklvrm
sasqlealcpqvinaalalaakpqsklaqenmdlfkeqwekqvrvltdavddits

SCOPe Domain Coordinates for d1l7cc1:

Click to download the PDB-style file with coordinates for d1l7cc1.
(The format of our PDB-style files is described here.)

Timeline for d1l7cc1: