SCOPe 2.06: Domain d1l6ya_: 1l6y A:

Lineage for d1l6ya_ (1l6y A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins)
   hybrid of classes I and II aldolase
   automatically mapped to Pfam PF00490

6. Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species)

7. Species Escherichia coli [TaxId:562] [51598] (4 PDB entries)

8. Domain d1l6ya_: 1l6y A: [73645]
   complexed with 4ox, gol, mg, zn

Details for d1l6ya_

PDB Entry: 1l6y, 1.9 Å

PDB Description: Crystal Structure of Porphobilinogen Synthase Complexed with the Inhibitor 4-Oxosebacic Acid

PDB Compounds: (A:) porphobilinogen synthase

SCOPe Domain Sequences for d1l6ya_:

Sequence; same for both SEQRES and ATOM records:

>d1l6ya_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli [TaxId: 562]}
tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl
areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf
ceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda
agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga
dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi
kragadlifsyfaldlaekkilr

Timeline for d1l6ya_:

• d1l6ya_ first appeared in SCOP 1.61
  
• d1l6ya_ appears in SCOPe 2.05
  
• d1l6ya_ appears in SCOPe 2.07
  
• d1l6ya_ appears in the current release, SCOPe 2.08