Lineage for d1l6ya_ (1l6y A:)
- Root: SCOP 1.63
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.10: Aldolase [51569] (4 families) 
Common fold covers whole protein structure
Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (1 protein)
hybrid of classes I and II aldolaseProtein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (4 species) 
Species Escherichia coli [TaxId:562] [51598] (4 PDB entries) 
Domain d1l6ya_: 1l6y A: [73645]
Details for d1l6ya_
PDB Entry: 1l6y (more details), 1.9 Å
PDB Description: Crystal Structure of Porphobilinogen Synthase Complexed with the Inhibitor 4-Oxosebacic Acid
SCOP Domain Sequences for d1l6ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6ya_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli}
tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl
areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf
ceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda
agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga
dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi
kragadlifsyfaldlaekkilr
SCOP Domain Coordinates for d1l6ya_:
Click to download the PDB-style file with coordinates for d1l6ya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l6ya_:
- d1l6ya_ first appeared in SCOP 1.61
- d1l6ya_ appears in SCOP 1.65
- d1l6ya_ appears in the current release, SCOPe 2.08
View in 3D
