Class k: Designed proteins [58788] (42 folds) |
Fold k.13: Protein A Ig(Fc)-binding domain mimics [58863] (1 superfamily) |
Superfamily k.13.1: Protein A Ig(Fc)-binding domain mimics [58864] (1 family) |
Family k.13.1.1: Protein A Ig(Fc)-binding domain mimics [58865] (1 protein) |
Protein Protein A Ig(Fc)-binding domain mimics [58866] (1 species) |
Species Synthetic [58867] (7 PDB entries) |
Domain d1l6xb_: 1l6x B: [73644] Other proteins in same PDB: d1l6xa1, d1l6xa2 bound to Fc fragment of rituximab IgG1 |
PDB Entry: 1l6x (more details), 1.65 Å
SCOP Domain Sequences for d1l6xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6xb_ k.13.1.1 (B:) Protein A Ig(Fc)-binding domain mimics {Synthetic} fnmqcqrrfyealhdpnlneeqrnakiksirddc
Timeline for d1l6xb_: