SCOP 1.71: Domain d1l6xa2: 1l6x A:342-443

Lineage for d1l6xa2 (1l6x A:342-443)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88590] (22 PDB entries)

8. Domain d1l6xa2: 1l6x A:342-443 [73643]
   Other proteins in same PDB: d1l6xa1, d1l6xb_
   part of a Fc
   complexed with fuc, gal, man, nag

Details for d1l6xa2

PDB Entry: 1l6x, 1.65 Å

PDB Description: fc fragment of rituximab bound to a minimized version of the b-domain from protein a called z34c

SCOP Domain Sequences for d1l6xa2:

Sequence; same for both SEQRES and ATOM records:

>d1l6xa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens)}
qprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

Timeline for d1l6xa2:

• d1l6xa2 first appeared in SCOP 1.61
  
• d1l6xa2 appears in SCOP 1.69
  
• d1l6xa2 appears in SCOP 1.73
  
• d1l6xa2 appears in the current release, SCOPe 2.08