![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins) hybrid of classes I and II aldolase automatically mapped to Pfam PF00490 |
![]() | Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species) |
![]() | Species Escherichia coli [TaxId:562] [51598] (4 PDB entries) |
![]() | Domain d1l6sa_: 1l6s A: [73627] complexed with dsb, mg, zn |
PDB Entry: 1l6s (more details), 1.7 Å
SCOPe Domain Sequences for d1l6sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6sa_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli [TaxId: 562]} tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf ceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi kragadlifsyfaldlaekkilr
Timeline for d1l6sa_: