Class g: Small proteins [56992] (94 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (3 families) |
Family g.14.1.2: Fibronectin type II module [57459] (4 proteins) shorter two-disulfide version of a kringle module |
Protein Gelatinase B (MMP-9) type II modules [75674] (1 species) duplication: tandem repeat of three modules inserted in the catalytic domain |
Species Human (Homo sapiens) [TaxId:9606] [75675] (1 PDB entry) |
Domain d1l6ja5: 1l6j A:332-390 [73623] Other proteins in same PDB: d1l6ja1, d1l6ja2 complexed with ca, zn |
PDB Entry: 1l6j (more details), 2.5 Å
SCOPe Domain Sequences for d1l6ja5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6ja5 g.14.1.2 (A:332-390) Gelatinase B (MMP-9) type II modules {Human (Homo sapiens) [TaxId: 9606]} radstvmggnsagelcvfpftflgkeystctsegrgdgrlwcattsnfdsdkkwgfcpd
Timeline for d1l6ja5:
View in 3D Domains from same chain: (mouse over for more information) d1l6ja1, d1l6ja2, d1l6ja3, d1l6ja4 |