Lineage for d1l6ja5 (1l6j A:332-390)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260117Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2260118Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2260280Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
    shorter two-disulfide version of a kringle module
  6. 2260315Protein Gelatinase B (MMP-9) type II modules [75674] (1 species)
    duplication: tandem repeat of three modules inserted in the catalytic domain
  7. 2260316Species Human (Homo sapiens) [TaxId:9606] [75675] (1 PDB entry)
  8. 2260319Domain d1l6ja5: 1l6j A:332-390 [73623]
    Other proteins in same PDB: d1l6ja1, d1l6ja2
    complexed with ca, zn

Details for d1l6ja5

PDB Entry: 1l6j (more details), 2.5 Å

PDB Description: Crystal structure of human matrix metalloproteinase MMP9 (gelatinase B).
PDB Compounds: (A:) Matrix metalloproteinase-9

SCOPe Domain Sequences for d1l6ja5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6ja5 g.14.1.2 (A:332-390) Gelatinase B (MMP-9) type II modules {Human (Homo sapiens) [TaxId: 9606]}
radstvmggnsagelcvfpftflgkeystctsegrgdgrlwcattsnfdsdkkwgfcpd

SCOPe Domain Coordinates for d1l6ja5:

Click to download the PDB-style file with coordinates for d1l6ja5.
(The format of our PDB-style files is described here.)

Timeline for d1l6ja5: