SCOPe 2.06: Domain d1l6ja3: 1l6j A:216-274

Lineage for d1l6ja3 (1l6j A:216-274)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
   shorter two-disulfide version of a kringle module

6. Protein Gelatinase B (MMP-9) type II modules [75674] (1 species)
   duplication: tandem repeat of three modules inserted in the catalytic domain

7. Species Human (Homo sapiens) [TaxId:9606] [75675] (1 PDB entry)

8. Domain d1l6ja3: 1l6j A:216-274 [73621]
   Other proteins in same PDB: d1l6ja1, d1l6ja2
   complexed with ca, zn

Details for d1l6ja3

PDB Entry: 1l6j, 2.5 Å

PDB Description: Crystal structure of human matrix metalloproteinase MMP9 (gelatinase B).

PDB Compounds: (A:) Matrix metalloproteinase-9

SCOPe Domain Sequences for d1l6ja3:

Sequence; same for both SEQRES and ATOM records:

>d1l6ja3 g.14.1.2 (A:216-274) Gelatinase B (MMP-9) type II modules {Human (Homo sapiens) [TaxId: 9606]}
vvvptrfgnadgaachfpfifegrsysacttdgrsdglpwcsttanydtddrfgfcpse

Timeline for d1l6ja3:

• d1l6ja3 first appeared in SCOP 1.61
  
• d1l6ja3 appears in SCOPe 2.05
  
• d1l6ja3 appears in SCOPe 2.07
  
• d1l6ja3 appears in the current release, SCOPe 2.08