Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein Gelatinase B (MMP-9) [75496] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75497] (18 PDB entries) |
Domain d1l6ja2: 1l6j A:106-215,A:391-444 [73620] Other proteins in same PDB: d1l6ja1, d1l6ja3, d1l6ja4, d1l6ja5 complexed with ca, zn |
PDB Entry: 1l6j (more details), 2.5 Å
SCOPe Domain Sequences for d1l6ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6ja2 d.92.1.11 (A:106-215,A:391-444) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} rfqtfegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdad iviqfgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgXqgyslflva ahefghalgldhssvpealmypmyrftegpplhkddvngirhlyg
Timeline for d1l6ja2:
View in 3D Domains from same chain: (mouse over for more information) d1l6ja1, d1l6ja3, d1l6ja4, d1l6ja5 |