Lineage for d1l6ja2 (1l6j A:106-215,A:391-444)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570846Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2570990Protein Gelatinase B (MMP-9) [75496] (1 species)
  7. 2570991Species Human (Homo sapiens) [TaxId:9606] [75497] (18 PDB entries)
  8. 2571007Domain d1l6ja2: 1l6j A:106-215,A:391-444 [73620]
    Other proteins in same PDB: d1l6ja1, d1l6ja3, d1l6ja4, d1l6ja5
    complexed with ca, zn

Details for d1l6ja2

PDB Entry: 1l6j (more details), 2.5 Å

PDB Description: Crystal structure of human matrix metalloproteinase MMP9 (gelatinase B).
PDB Compounds: (A:) Matrix metalloproteinase-9

SCOPe Domain Sequences for d1l6ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6ja2 d.92.1.11 (A:106-215,A:391-444) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
rfqtfegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdad
iviqfgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgXqgyslflva
ahefghalgldhssvpealmypmyrftegpplhkddvngirhlyg

SCOPe Domain Coordinates for d1l6ja2:

Click to download the PDB-style file with coordinates for d1l6ja2.
(The format of our PDB-style files is described here.)

Timeline for d1l6ja2: