SCOPe 2.06: Domain d1l6ja2: 1l6j A:106-215,A:391-444

Lineage for d1l6ja2 (1l6j A:106-215,A:391-444)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Gelatinase B (MMP-9) [75496] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75497] (16 PDB entries)

8. Domain d1l6ja2: 1l6j A:106-215,A:391-444 [73620]
   Other proteins in same PDB: d1l6ja1, d1l6ja3, d1l6ja4, d1l6ja5
   complexed with ca, zn

Details for d1l6ja2

PDB Entry: 1l6j, 2.5 Å

PDB Description: Crystal structure of human matrix metalloproteinase MMP9 (gelatinase B).

PDB Compounds: (A:) Matrix metalloproteinase-9

SCOPe Domain Sequences for d1l6ja2:

Sequence; same for both SEQRES and ATOM records:

>d1l6ja2 d.92.1.11 (A:106-215,A:391-444) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
rfqtfegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdad
iviqfgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgXqgyslflva
ahefghalgldhssvpealmypmyrftegpplhkddvngirhlyg

Timeline for d1l6ja2:

• d1l6ja2 first appeared in SCOP 1.61
  
• d1l6ja2 appears in SCOPe 2.05
  
• d1l6ja2 appears in SCOPe 2.07
  
• d1l6ja2 appears in the current release, SCOPe 2.08