Lineage for d1l6ja1 (1l6j A:29-105)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697917Fold a.20: PGBD-like [47089] (1 superfamily)
    core: 3 helices; bundle, closed, left-handed twist; parallel
  4. 2697918Superfamily a.20.1: PGBD-like [47090] (3 families) (S)
  5. 2697928Family a.20.1.2: MMP N-terminal domain [63427] (4 proteins)
  6. 2697942Protein Gelatinase B (MMP-9) [74703] (1 species)
  7. 2697943Species Human (Homo sapiens) [TaxId:9606] [74704] (1 PDB entry)
  8. 2697944Domain d1l6ja1: 1l6j A:29-105 [73619]
    Other proteins in same PDB: d1l6ja2, d1l6ja3, d1l6ja4, d1l6ja5
    complexed with ca, zn

Details for d1l6ja1

PDB Entry: 1l6j (more details), 2.5 Å

PDB Description: Crystal structure of human matrix metalloproteinase MMP9 (gelatinase B).
PDB Compounds: (A:) Matrix metalloproteinase-9

SCOPe Domain Sequences for d1l6ja1:

Sequence, based on SEQRES records: (download)

>d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
vlfpgdlrtnltdrqlaeeylyrygytrvaemrgeskslgpallllqkqlslpetgelds
atlkamrtprcgvpdlg

Sequence, based on observed residues (ATOM records): (download)

>d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
vlfpgdlrtnltdrqlaeeylyrygytlgpallllqkqlslpetgeldsatlkamrtprc
gvpdlg

SCOPe Domain Coordinates for d1l6ja1:

Click to download the PDB-style file with coordinates for d1l6ja1.
(The format of our PDB-style files is described here.)

Timeline for d1l6ja1: