Lineage for d1l6ga2 (1l6g A:12-244)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305533Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 305534Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)
  6. 305535Protein Alanine racemase [51421] (1 species)
  7. 305536Species Bacillus stearothermophilus [TaxId:1422] [51422] (7 PDB entries)
  8. 305543Domain d1l6ga2: 1l6g A:12-244 [73614]
    Other proteins in same PDB: d1l6ga1, d1l6gb1

Details for d1l6ga2

PDB Entry: 1l6g (more details), 2 Å

PDB Description: Alanine racemase bound with N-(5'-phosphopyridoxyl)-D-alanine

SCOP Domain Sequences for d1l6ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6ga2 c.1.6.1 (A:12-244) Alanine racemase {Bacillus stearothermophilus}
vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal
alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd
tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew
lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea

SCOP Domain Coordinates for d1l6ga2:

Click to download the PDB-style file with coordinates for d1l6ga2.
(The format of our PDB-style files is described here.)

Timeline for d1l6ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l6ga1