Lineage for d1l6fb2 (1l6f B:12-244)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437734Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 2437735Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins)
  6. 2437736Protein Alanine racemase [51421] (3 species)
  7. 2437737Species Bacillus stearothermophilus [TaxId:1422] [51422] (8 PDB entries)
  8. 2437745Domain d1l6fb2: 1l6f B:12-244 [73612]
    Other proteins in same PDB: d1l6fa1, d1l6fb1
    complexed with pp3

Details for d1l6fb2

PDB Entry: 1l6f (more details), 2 Å

PDB Description: Alanine racemase bound with N-(5'-phosphopyridoxyl)-L-alanine
PDB Compounds: (B:) alanine racemase

SCOPe Domain Sequences for d1l6fb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6fb2 c.1.6.1 (B:12-244) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]}
vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal
alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd
tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew
lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea

SCOPe Domain Coordinates for d1l6fb2:

Click to download the PDB-style file with coordinates for d1l6fb2.
(The format of our PDB-style files is described here.)

Timeline for d1l6fb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l6fb1