SCOP 1.69: Domain d1l6fa2: 1l6f A:12-244

Lineage for d1l6fa2 (1l6f A:12-244)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.6: PLP-binding barrel [51419] (2 families)
   circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand

5. Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)

6. Protein Alanine racemase [51421] (3 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51422] (8 PDB entries)

8. Domain d1l6fa2: 1l6f A:12-244 [73610]
   Other proteins in same PDB: d1l6fa1, d1l6fb1

Details for d1l6fa2

PDB Entry: 1l6f, 2 Å

PDB Description: Alanine racemase bound with N-(5'-phosphopyridoxyl)-L-alanine

SCOP Domain Sequences for d1l6fa2:

Sequence; same for both SEQRES and ATOM records:

>d1l6fa2 c.1.6.1 (A:12-244) Alanine racemase {Bacillus stearothermophilus}
vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal
alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd
tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew
lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea

Timeline for d1l6fa2:

• d1l6fa2 first appeared in SCOP 1.61
  
• d1l6fa2 appears in SCOP 1.67
  
• d1l6fa2 appears in SCOP 1.71
  
• d1l6fa2 appears in the current release, SCOPe 2.08