![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.6: PLP-binding barrel [51419] (2 families) ![]() circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand |
![]() | Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins) |
![]() | Protein Alanine racemase [51421] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [51422] (7 PDB entries) |
![]() | Domain d1l6fa2: 1l6f A:12-244 [73610] Other proteins in same PDB: d1l6fa1, d1l6fb1 |
PDB Entry: 1l6f (more details), 2 Å
SCOP Domain Sequences for d1l6fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6fa2 c.1.6.1 (A:12-244) Alanine racemase {Bacillus stearothermophilus} vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea
Timeline for d1l6fa2: