SCOP 1.67: Domain d1l6fa1: 1l6f A:2-11,A:245-383

Lineage for d1l6fa1 (1l6f A:2-11,A:245-383)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.2: Alanine racemase [88682] (1 protein)

6. Protein Alanine racemase [50623] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [50624] (8 PDB entries)

8. Domain d1l6fa1: 1l6f A:2-11,A:245-383 [73609]
   Other proteins in same PDB: d1l6fa2, d1l6fb2

Details for d1l6fa1

PDB Entry: 1l6f, 2 Å

PDB Description: Alanine racemase bound with N-(5'-phosphopyridoxyl)-L-alanine

SCOP Domain Sequences for d1l6fa1:

Sequence; same for both SEQRES and ATOM records:

>d1l6fa1 b.49.2.2 (A:2-11,A:245-383) Alanine racemase {Bacillus stearothermophilus}
ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq
hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin
yevpctisyrvpriffrhkrimevrnaigr

Timeline for d1l6fa1:

• d1l6fa1 first appeared in SCOP 1.61
  
• d1l6fa1 appears in SCOP 1.65
  
• d1l6fa1 appears in SCOP 1.69
  
• d1l6fa1 appears in the current release, SCOPe 2.08