Lineage for d1l6ea1 (1l6e A:2-46)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995557Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 1995558Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) (S)
    dimer of identical alpha-hairpin motifs
  5. 1995559Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)
  6. 1995567Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species)
  7. 1995568Species Mouse (Mus musculus) [TaxId:10090] [47394] (4 PDB entries)
  8. 1995575Domain d1l6ea1: 1l6e A:2-46 [73607]
    Other proteins in same PDB: d1l6ea2, d1l6eb2

Details for d1l6ea1

PDB Entry: 1l6e (more details)

PDB Description: solution structure of the docking and dimerization domain of protein kinase a ii-alpha (riialpha d/d). alternatively called the n-terminal dimerization domain of the regulatory subunit of protein kinase a.
PDB Compounds: (A:) cAMP-dependent protein kinase Type II-alpha regulatory chain

SCOPe Domain Sequences for d1l6ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6ea1 a.31.1.1 (A:2-46) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]}
mghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr

SCOPe Domain Coordinates for d1l6ea1:

Click to download the PDB-style file with coordinates for d1l6ea1.
(The format of our PDB-style files is described here.)

Timeline for d1l6ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l6ea2