Lineage for d1l6ea_ (1l6e A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
4 helices; bundle, closed, right-handed twistSuperfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) 
dimer of identical alpha-hairpin motifsFamily a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins) 
Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [47394] (4 PDB entries) 
Domain d1l6ea_: 1l6e A: [73607]
Details for d1l6ea_
PDB Entry: 1l6e (more details)
PDB Description: solution structure of the docking and dimerization domain of protein kinase a ii-alpha (riialpha d/d). alternatively called the n-terminal dimerization domain of the regulatory subunit of protein kinase a.
PDB Compounds: (A:) cAMP-dependent protein kinase Type II-alpha regulatory chainSCOPe Domain Sequences for d1l6ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6ea_ a.31.1.1 (A:) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]}
hmghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
SCOPe Domain Coordinates for d1l6ea_:
Click to download the PDB-style file with coordinates for d1l6ea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l6ea_:
- d1l6ea_ first appeared in SCOP 1.61
- d1l6ea_ appears in SCOPe 2.04
- d1l6ea_ is called d1l6ea1 in SCOPe 2.06
- d1l6ea_ appears in the current release, SCOPe 2.08, called d1l6ea1
View in 3D
